PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00020136001
Common NameGSBRNA2T00020136001, LOC106452529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 504aa    MW: 55488.1 Da    PI: 5.4559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00020136001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25e-153683148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT  Ed +l+++v+++G g+W+++ ++  + R++k+c++rw ++l
  GSBRNA2T00020136001 36 KGPWTSTEDGILINYVRKHGEGNWNAVQKYTSLARCGKSCRLRWANHL 83
                         79******************************************9986 PP

2Myb_DNA-binding49.69e-1689132146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++++eE+ l+v+ ++++G++ W+  a++++ gRt++++k++w++
  GSBRNA2T00020136001  89 KGAFSQEEERLIVQMHAKMGNK-WAQMAEHLP-GRTDNEIKNYWNT 132
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7983183IPR017930Myb domain
SuperFamilySSF466895.03E-2935130IPR009057Homeodomain-like
SMARTSM007176.8E-113585IPR001005SANT/Myb domain
PfamPF002491.2E-133683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-223790IPR009057Homeodomain-like
CDDcd001672.25E-93883No hitNo description
PROSITE profilePS5129425.21584138IPR017930Myb domain
SMARTSM007171.0E-1688136IPR001005SANT/Myb domain
PfamPF002491.4E-1489132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2591137IPR009057Homeodomain-like
CDDcd001673.22E-1291132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSYTAESDDD GMHSPAGDSI GGYGCKSRGK GSVLKKGPWT STEDGILINY VRKHGEGNWN  60
AVQKYTSLAR CGKSCRLRWA NHLRPNLKKG AFSQEEERLI VQMHAKMGNK WAQMAEHLPG  120
RTDNEIKNYW NTRIKRRHRA GLPLYPPELH VEDLQWSEEY TTSNVTRVNR RRHQDILQLG  180
NSKADVLFDD LNFATNLLPG ASDVLDMFTC NMLGTGASSS PYESYMPPIL PSPKQLRDSG  240
SLFPMCSSNI KQEFHSPEPF QNPRSCSISP CDVGHHSPYG NQRPSDVMIS DSHAFTDGML  300
PTSKPLFGAV KLELPSFQYS ETSGFDQWKT TTPSPPHSDP LDSVDAYIQS PPPLEIEEDE  360
SNCFSSCDTG LLDMLLPNAK IKTSAKRSLA LPEIPIPTQL SAGETSPDSA GNVVKTEELD  420
QVWEPKRVDI TRPDVLLGSS WLDQQGCFGI VRDSSNMSDA LALLLGGEDI ENSYVTVGSS  480
SSGQAQQGVG SCTWTNMPPV WSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-32331371104C-Myb DNA-Binding Domain
1mse_C5e-32331371104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895470.0AC189547.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH004P05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750131.10.0PREDICTED: transcription factor GAMYB isoform X1
RefseqXP_013750130.10.0PREDICTED: transcription factor GAMYB isoform X1
TrEMBLA0A078J1770.0A0A078J177_BRANA; BnaCnng31260D protein
STRINGBra034842.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]